PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19507.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TALE
Protein Properties Length: 471aa    MW: 52130.7 Da    PI: 7.2758
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19507.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.1e-094054382255
                              SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                 Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                               +yps++++  LA+++gL+++q+ +WF N+R ++
  mrna19507.1-v1.0-hybrid 405 WPYPSESQKLSLAESTGLDQKQINNWFINQRKRH 438
                              69*****************************885 PP

2ELK40.75e-14358379122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELK qLlrKYsgyLgsLkqEF+
  mrna19507.1-v1.0-hybrid 358 ELKGQLLRKYSGYLGSLKQEFM 379
                              9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.2E-20207251IPR005540KNOX1
PfamPF037901.2E-21209247IPR005540KNOX1
SMARTSM012561.8E-22265316IPR005541KNOX2
PfamPF037913.9E-20269315IPR005541KNOX2
SMARTSM011882.8E-8358379IPR005539ELK domain
PfamPF037898.2E-11358379IPR005539ELK domain
PROSITE profilePS5121311.174358378IPR005539ELK domain
PROSITE profilePS5007113.054378441IPR001356Homeobox domain
SuperFamilySSF466892.74E-19380456IPR009057Homeodomain-like
SMARTSM003899.7E-13380445IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.5E-28383444IPR009057Homeodomain-like
CDDcd000865.41E-12390442No hitNo description
PfamPF059204.4E-17398437IPR008422Homeobox KN domain
PROSITE patternPS000270416439IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MNPLVIEKNL DGEVGGNPIV RMQEASGGMV FEVGMLKEAP TQEPEVEVLM FEAQAKKSEG  60
LKKRTRQVRI LNEWTDCHQA PVVNKIKQQR CLSGSASKEG QSVFIGKGGS NGSNSTAFGD  120
NPTNNNGGGL FPMTVMMPLM TTTNSQHHHL AQLHSNNSPF VLLPPNYNNH HQQDQNNPAA  180
VVGCYFMDHN TNNGGHGSSS SSSSSSSSIK SKIMAHPHYH RLLAAYINCQ KVGAPPEVVG  240
RLEEACESAA TVGQMVRCSS GSGDGHGSLG EDPALDQFME AYCEMLIKYE QEVSKPFKEA  300
MLFLQKIESQ FTALTVSSAS ATDSGYGEGG MDRNNKGSSE EVDVNNNLLV DPQAEDRELK  360
GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQKLLDWWS RHYKWPYPSE SQKLSLAEST  420
GLDQKQINNW FINQRKRHWK PSEDMQIMVM DASHPTHYYM NNMDVSPSLL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1373382LKQEFMKKRK
2379383KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293325.10.0PREDICTED: homeobox protein SBH1 isoform X1
SwissprotP466081e-132HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD3IWE91e-152D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2
STRINGVIT_10s0116g00190.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-121KNOX/ELK homeobox transcription factor